PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_31366
Common NameKK1_030347
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family LBD
Protein Properties Length: 282aa    MW: 31447.5 Da    PI: 6.4368
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_31366genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.11.3e-4271061100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrrkC+++Cv+apyfp ++p++fa+vh++FGasnv kll++l+  +reda++sl+yeAear+rdPvyG+vg+i+ lqq+l+q ++el+ 
  C.cajan_31366   7 PCAACKLLRRKCTQECVFAPYFPPDNPQRFACVHRVFGASNVAKLLNELSMAQREDAVKSLAYEAEARLRDPVYGCVGFISLLQQRLRQIQTELHN 102
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +k+e
  C.cajan_31366 103 AKKE 106
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4646107IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-427104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MSSSNSPCAA CKLLRRKCTQ ECVFAPYFPP DNPQRFACVH RVFGASNVAK LLNELSMAQR  60
EDAVKSLAYE AEARLRDPVY GCVGFISLLQ QRLRQIQTEL HNAKKELSTY VSPQAMQVLL  120
ANPGMLPPML PHLHHQSMFN NCGGANNVAS QVLVAHGGGG GDQMVIRDTP PQEFLEAQQM  180
ALHQHQHQHQ VMFRNYEEQE FMKFDNGFEQ SGGGFGSQVE CLPPSLSLGS FENVGPYPVQ  240
QHGEQQHPME AQLLLTPQQQ QSQEQPHQQR CESEDGRTVV PA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525697.11e-115PREDICTED: LOB domain-containing protein 36-like
TrEMBLA0A151RZM50.0A0A151RZM5_CAJCA; LOB domain-containing protein 36
STRINGGLYMA05G09950.21e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-58ASYMMETRIC LEAVES 2-like 1